Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB02285"

No prefix for http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/.
PredicateValue (sorted: default)
rdfs:label
"Protoporphyrin Ix"
rdf:type
ns1:description
" 553-12-8 experimental Elaine A. Best, Charles Lee Hershberger, Christopher Carl Frye, "Methods of reducing the levels of protoporphyrin IX in recombinant hemoglobin preparations." U.S. Patent US6136565, issued April, 1998. logP 4.47 ALOGPS logS -4.4 ALOGPS Water Solubility 2.26e-02 g/l ALOGPS logP 6.61 ChemAxon Molecular Weight 561.6502 ChemAxon Monoisotopic Weight 561.250180564 ChemAxon SMILES CC1=C(CCC(O)=O)\C2=C\c3nc(C=C4N=C(C=C5N\C(=C/C1=N2)C(C=C)=C5C)C(C=C)=C4C)c(C)c3CCC(O)=O ChemAxon Molecular Formula C34H33N4O4 ChemAxon Polar Surface Area (PSA) 129.06 ChemAxon Refractivity 162.05 ChemAxon Polarizability 65.75 ChemAxon Rotatable Bond Count 8 ChemAxon H Bond Acceptor Count 7 ChemAxon H Bond Donor Count 3 ChemAxon pKa (strongest acidic) 3.24 ChemAxon pKa (strongest basic) 4.98 ChemAxon Physiological Charge -2 ChemAxon Number of Rings 5 ChemAxon Bioavailability 0 ChemAxon MDDR-Like Rule true ChemAxon Water Solubility 169 mg/L (at 25 °C) YALKOWSKY,SH & DANNENFELSER,RM (1992) ChEBI 15430 PubChem Compound 4971 PubChem Substance 46506247 KEGG Compound C02191 BindingDB 50004784 PDB PP9 SMP00344 Acute Intermittent Porphyria DB00145 Glycine DB01592 Iron DB01593 Zinc DB02285 Protoporphyrin Ix DB03435 Uridine-5'-Diphosphate DB04461 Coproporphyrin Iii P13196 P13716 P08397 P10746 P06132 P36551 P50336 Q8N4E7 P22830 Q12887 Q7KZN9 P09601 P53004 O75310 P08236 SMP00345 Congenital Erythropoietic Porphyria (CEP) or Gunther Disease DB00145 Glycine DB01592 Iron DB01593 Zinc DB02285 Protoporphyrin Ix DB03435 Uridine-5'-Diphosphate DB04461 Coproporphyrin Iii P13196 P13716 P08397 P10746 P06132 P36551 P50336 Q8N4E7 P22830 Q12887 Q7KZN9 P09601 P53004 O75310 P08236 SMP00342 Hereditary Coproporphyria (HCP) DB00145 Glycine DB01592 Iron DB01593 Zinc DB02285 Protoporphyrin Ix DB03435 Uridine-5'-Diphosphate DB04461 Coproporphyrin Iii P13196 P13716 P08397 P10746 P06132 P36551 P50336 Q8N4E7 P22830 Q12887 Q7KZN9 P09601 P53004 O75310 P08236 SMP00024 Porphyrin Metabolism DB00145 Glycine DB01592 Iron DB01593 Zinc DB02285 Protoporphyrin Ix DB03435 Uridine-5'-Diphosphate DB04461 Coproporphyrin Iii P13196 P13716 P08397 P10746 P06132 P36551 P50336 Q8N4E7 P22830 Q12887 Q7KZN9 P09601 P53004 O75310 P08236 SMP00346 Porphyria Variegata (PV) DB00145 Glycine DB01592 Iron DB01593 Zinc DB02285 Protoporphyrin Ix DB03435 Uridine-5'-Diphosphate DB04461 Coproporphyrin Iii P13196 P13716 P08397 P10746 P06132 P36551 P50336 Q8N4E7 P22830 Q12887 Q7KZN9 P09601 P53004 O75310 P08236 BE0000085 Ferritin light chain Human # Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17139284 # Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17016423 # Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/10592235 unknown Ferritin light chain Inorganic ion transport and metabolism Stores iron in a soluble, nontoxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation FTL 19q13.3-q13.4 None 5.59 19889.0 Human HUGO Gene Nomenclature Committee (HGNC) HGNC:3999 GenAtlas FTL GeneCards FTL GenBank Gene Database M11147 GenBank Protein Database 182514 UniProtKB P02792 UniProt Accession FRIL_HUMAN Ferritin L subunit >Ferritin light chain SSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKRE GYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSAR TDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD >528 bp ATGAGCTCCCAGATTCGTCAGAATTATTCCACCGACGTGGAGGCAGCCGTCAACAGCCTG GTCAATTTGTACCTGCAGGCCTCCTACACCTACCTCTCTCTGGGCTTCTATTTCGACCGC GATGATGTGGCTCTGGAAGGCGTGAGCCACTTCTTCCGCGAACTGGCCGAGGAGAAGCGC GAGGGCTACGAGCGTCTCCTGAAGATGCAAAACCAGCGTGGCGGCCGCGCTCTCTTCCAG GACATCAAGAAGCCAGCTGAAGATGAGTGGGGTAAAACCCCAGACGCCATGAAAGCTGCC ATGGCCCTGGAGAAAAAGCTGAACCAGGCCCTTTTGGATCTTCATGCCCTGGGTTCTGCC CGCACGGACCCCCATCTCTGTGACTTCCTGGAGACTCACTTCCTAGATGAGGAAGTGAAG CTTATCAAGAAGATGGGTGACCACCTGACCAACCTCCACAGGCTGGGTGGCCCGGAGGCT GGGCTGGGCGAGTATCTCTTCGAAAGGCTCACTCTCAAGCACGACTAA PF00210 Ferritin function iron ion binding function binding function ferric iron binding function ion binding function cation binding function transition metal ion binding process iron ion homeostasis process transport process transition metal ion transport process ion transport process iron ion transport process cation transport process di-, tri-valent inorganic cation transport process physiological process process homeostasis process cellular physiological process process cell homeostasis process cell ion homeostasis process cation homeostasis process di-, tri-valent inorganic cation homeostasis "
owl:sameAs

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines/drugbank_small.nt

The resource appears as object in 6 triples

Context graph