Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB03087"

No prefix for http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/.
PredicateValue (sorted: none)
ns1:description
" experimental This compound belongs to the thiazoles. These are heterocyclic compounds containing a five-member aromatic ring made up of one sulfur atom, one nitrogen, and three carbon atoms. Thiazoles Organic Compounds Heterocyclic Compounds Azoles Thiazoles Polyamines polyamine organonitrogen compound logP 3.06 ALOGPS logS -2.3 ALOGPS Water Solubility 6.67e-01 g/l ALOGPS logP 2.44 ChemAxon IUPAC Name 2-[(2R)-butan-2-yl]-1,3-thiazole ChemAxon Traditional IUPAC Name 2-(sec-butyl)thiazole ChemAxon Molecular Weight 141.234 ChemAxon Monoisotopic Weight 141.061220047 ChemAxon SMILES CC[C@@H](C)C1=NC=CS1 ChemAxon Molecular Formula C7H11NS ChemAxon InChI InChI=1S/C7H11NS/c1-3-6(2)7-8-4-5-9-7/h4-6H,3H2,1-2H3/t6-/m1/s1 ChemAxon InChIKey InChIKey=MHJSWOZJMPIGJQ-ZCFIWIBFSA-N ChemAxon Polar Surface Area (PSA) 12.89 ChemAxon Refractivity 39.51 ChemAxon Polarizability 15.76 ChemAxon Rotatable Bond Count 2 ChemAxon H Bond Acceptor Count 1 ChemAxon H Bond Donor Count 0 ChemAxon pKa (strongest basic) 3.34 ChemAxon Physiological Charge 0 ChemAxon Number of Rings 1 ChemAxon Bioavailability 1 ChemAxon Rule of Five true ChemAxon PubChem Compound 5289510 PubChem Substance 46504943 PDB TZL BE0004320 Epididymal-specific lipocalin-9 Human # Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17139284 # Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17016423 # Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/10592235 unknown Epididymal-specific lipocalin-9 Involved in pheromone binding LCN9 9q34.3 Secreted None 5.62 21807.5 Human HUGO Gene Nomenclature Committee (HGNC) GNC:17442 GeneCards LCN9 GenBank Gene Database AY301270 GenBank Protein Database 34761575 UniProtKB Q8WX39 UniProt Accession LCN9_HUMAN MUP-like lipocalin >Epididymal-specific lipocalin-9 MALLLLSLGLSLIAAQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFV RNIEHLKNGSLIFDFEYMVQGECVAVVVVCEKTEKNGEYSINYEGQNTVAVSETDYRLFI TFHLQNFRNGTETHTLALYGTSALEPSFLSRFEETCEKYGLGSQNIIDLTNKDPCYSKHY RSPPRPPMRW PF00061 Lipocalin function transporter activity function odorant binding function pheromone binding function binding process cellular physiological process process transport process physiological process "
rdfs:label
"2-(Sec-Butyl)Thiazole"
rdf:type
owl:sameAs

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines/drugbank_small.nt

The resource does not appear as an object

Context graph