Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB03121"

No prefix for http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/.
PredicateValue (sorted: default)
rdfs:label
"1-Benzyl-5-Methoxy-2-Methyl-1h-Indol-3-Yl)-Acetic Acid"
rdf:type
ns1:description
" experimental This compound belongs to the indole-3-acetic acid derivatives. These are compounds containing an acetic acid (or a derivative) linked to the C3 carbon atom of an indole. Indole-3-acetic Acid Derivatives Organic Compounds Heterocyclic Compounds Indoles and Derivatives Indolyl Carboxylic Acids and Derivatives Indoles Anisoles Alkyl Aryl Ethers N-substituted Pyrroles Enolates Carboxylic Acids Polyamines indole anisole phenol ether alkyl aryl ether benzene substituted pyrrole n-substituted pyrrole pyrrole polyamine enolate ether carboxylic acid derivative carboxylic acid amine organonitrogen compound logP 3.82 ALOGPS logS -4.5 ALOGPS Water Solubility 1.01e-02 g/l ALOGPS logP 3.7 ChemAxon IUPAC Name 2-(1-benzyl-5-methoxy-2-methyl-1H-indol-3-yl)acetic acid ChemAxon Traditional IUPAC Name (1-benzyl-5-methoxy-2-methylindol-3-yl)acetic acid ChemAxon Molecular Weight 309.3591 ChemAxon Monoisotopic Weight 309.136493479 ChemAxon SMILES COC1=CC2=C(C=C1)N(CC1=CC=CC=C1)C(C)=C2CC(O)=O ChemAxon Molecular Formula C19H19NO3 ChemAxon InChI InChI=1S/C19H19NO3/c1-13-16(11-19(21)22)17-10-15(23-2)8-9-18(17)20(13)12-14-6-4-3-5-7-14/h3-10H,11-12H2,1-2H3,(H,21,22) ChemAxon InChIKey InChIKey=ZEKCBTQHDTUHRJ-UHFFFAOYSA-N ChemAxon Polar Surface Area (PSA) 51.46 ChemAxon Refractivity 89.57 ChemAxon Polarizability 33.54 ChemAxon Rotatable Bond Count 5 ChemAxon H Bond Acceptor Count 3 ChemAxon H Bond Donor Count 1 ChemAxon pKa (strongest acidic) 4.45 ChemAxon pKa (strongest basic) -4.8 ChemAxon Physiological Charge -1 ChemAxon Number of Rings 3 ChemAxon Bioavailability 1 ChemAxon Rule of Five true ChemAxon Ghose Filter true ChemAxon PubChem Compound 1372 PubChem Substance 46505875 ChemSpider 1331 PDB I3N BE0001640 Phospholipase A2, membrane associated Human # Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17139284 # Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/17016423 # Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/10592235 unknown Phospholipase A2, membrane associated Involved in phospholipase A2 activity Thought to participate in the regulation of the phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides PLA2G2A 1p35 Membrane; peripheral membrane protein None 9.51 16083.0 Human HUGO Gene Nomenclature Committee (HGNC) HGNC:9031 GenAtlas PLA2G2A GeneCards PLA2G2A GenBank Gene Database M22430 GenBank Protein Database 190889 UniProtKB P14555 UniProt Accession PA2GA_HUMAN EC 3.1.1.4 GIIC sPLA2 Group IIA phospholipase A2 Non-pancreatic secretory phospholipase A2 NPS-PLA2 Phosphatidylcholine 2-acylhydrolase Phospholipase A2, membrane associated precursor >Phospholipase A2, membrane associated precursor MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR NKTTYNKKYQYYSNKHCRGSTPRC >435 bp ATGAAGACCCTCCTACTGTTGGCAGTGATCATGATCTTTGGCCTACTGCAGGCCCATGGG AATTTGGTGAATTTCCACAGAATGATCAAGTTGACGACAGGAAAGGAAGCCGCACTCAGT TATGGCTTCTACGGCTGCCACTGTGGCGTGGGTGGCAGAGGATCCCCCAAGGATGCAACG GATCGCTGCTGTGTCACTCATGACTGTTGCTACAAACGTCTGGAGAAACGTGGATGTGGC ACCAAATTTCTGAGCTACAAGTTTAGCAACTCGGGGAGCAGAATCACCTGTGCAAAACAG GACTCCTGCAGAAGTCAACTGTGTGAGTGTGATAAGGCTGCTGCCACCTGTTTTGCTAGA AACAAGACGACCTACAATAAAAAGTACCAGTACTATTCCAATAAACACTGCAGAGGGAGC ACCCCTCGTTGCTGA PF00068 Phospholip_A2_1 function ion binding function cation binding function calcium ion binding function hydrolase activity, acting on ester bonds function binding function carboxylic ester hydrolase activity function lipase activity function catalytic activity function phospholipase activity function phospholipase A2 activity function hydrolase activity process primary metabolism process lipid metabolism process physiological process process metabolism process lipid catabolism "
owl:sameAs

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines/drugbank_small.nt

The resource does not appear as an object

Context graph