Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB04682"

No prefix for http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/.
PredicateValue (sorted: default)
rdfs:label
"Octylphenoxy polyethoxyethanol"
rdf:type
ns1:description
" 9036-19-5 experimental This compound belongs to the cumenes. These are aromatic compounds containing a prop-2-ylbenzene moiety. Cumenes Organic Compounds Benzenoids Benzene and Substituted Derivatives Cumenes Phenol Ethers Alkyl Aryl Ethers Polyamines Primary Alcohols Isooctanes isooctane phenol ether alkyl aryl ether polyamine primary alcohol ether alcohol alkylphenol-hydroxypolyoxyetheylene Anapoe-305 Surface-Active Agents Antifoaming Agents Detergents Excipients Spermatocidal Agents logP 4.16 ALOGPS logS -5.2 ALOGPS Water Solubility 2.39e-03 g/l ALOGPS logP 4.01 ChemAxon IUPAC Name 1-[4-(2,4,4-trimethylpentan-2-yl)phenyl]-1,4,7,10-tetraoxadodecan-12-ol ChemAxon Traditional IUPAC Name triton X-305 ChemAxon Molecular Weight 382.5341 ChemAxon Monoisotopic Weight 382.271924326 ChemAxon SMILES CC(C)(C)CC(C)(C)C1=CC=C(OCCOCCOCCOCCO)C=C1 ChemAxon Molecular Formula C22H38O5 ChemAxon InChI InChI=1S/C22H38O5/c1-21(2,3)18-22(4,5)19-6-8-20(9-7-19)27-17-16-26-15-14-25-13-12-24-11-10-23/h6-9,23H,10-18H2,1-5H3 ChemAxon InChIKey InChIKey=UYDLBVPAAFVANX-UHFFFAOYSA-N ChemAxon Polar Surface Area (PSA) 57.15 ChemAxon Refractivity 108.84 ChemAxon Polarizability 46.64 ChemAxon Rotatable Bond Count 15 ChemAxon H Bond Acceptor Count 5 ChemAxon H Bond Donor Count 1 ChemAxon pKa (strongest acidic) 15.12 ChemAxon pKa (strongest basic) -2.7 ChemAxon Physiological Charge 0 ChemAxon Number of Rings 1 ChemAxon Bioavailability 1 ChemAxon Rule of Five true ChemAxon Ghose Filter true ChemAxon PubChem Compound 628327 PubChem Substance 46505911 PDB DR6 BE0003566 Troponin C, skeletal muscle Human # Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/10592235 unknown Troponin C, skeletal muscle Involved in calcium ion binding Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components:Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments TNNC2 20q12-q13.11 None 3.81 18121.9 Human HUGO Gene Nomenclature Committee (HGNC) GNC:11944 GeneCards TNNC2 GenBank Gene Database X07898 GenBank Protein Database 36729 UniProtKB P02585 UniProt Accession TNNC2_HUMAN >Troponin C, skeletal muscle MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ >483 bp ATGACGGACCAGCAGGCTGAGGCCAGGTCCTACCTCAGCGAAGAGATGATCGCTGAGTTC AAGGCTGCCTTTGACATGTTTGATGCTGATGGTGGTGGGGACATCAGCGTCAAGGAGTTG GGCACGGTGATGAGGATGCTGGGCCAGACACCCACCAAGGAGGAGCTGGACGCCATCATC GAGGAGGTGGATGAGGACGGCAGCGGCACCATCGACTTCGAGGAGTTCTTGGTCATGATG GTGCGCCAGATGAAAGAGGACGCGAAAGGGAAGAGCGAGGAGGAGCTGGCCGAGTGCTTC CGCATCTTCGACAGGAATGCAGACGGCTACATCGACCCGGAGGAGCTGGCTGAGATTTTC AGGGCCTCCGGGGAGCACGTGACTGACGAGGAGATCGAATCTCTGATGAAAGACGGCGAC AAGAACAACGACGGCCGCATTGACTTCGACGAGTTCCTGAAGATGATGGAGGGCGTGCAG TAA PF00036 efhand function binding function ion binding function cation binding function calcium ion binding "
ns1:drugCategory

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines/drugbank_small.nt

The resource does not appear as an object

Context graph