Local view for "http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB08485"

No prefix for http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/.
PredicateValue (sorted: none)
ns1:description
" experimental This compound belongs to the quinic acids and derivatives. These are compounds containing a quinic acid moiety (or a derivative thereof), whis is a cyclitol made up of a cyclohexane ring that bears four hydroxyl groups at positions 1,3.4, and 5, as well as a carboxylic acid at position 1. Quinic Acids and Derivatives Organic Compounds Organooxygen Compounds Alcohols and Polyols Cyclic Alcohols and Derivatives Benzene and Substituted Derivatives Alpha Hydroxy Acids and Derivatives Tertiary Alcohols Secondary Alcohols 1,2-Diols Enolates Carboxylic Acids Polyamines Thioethers hydroxy acid benzene alpha-hydroxy acid tertiary alcohol polyol 1,2-diol secondary alcohol enolate polyamine carboxylic acid carboxylic acid derivative thioether logP 1.8 ALOGPS logS -3.6 ALOGPS Water Solubility 8.93e-02 g/l ALOGPS logP 2.11 ChemAxon IUPAC Name (1R,4R,5R)-1,4,5-trihydroxy-3-[3-(phenylsulfanyl)phenyl]cyclohex-2-ene-1-carboxylic acid ChemAxon Traditional IUPAC Name (1R,4R,5R)-1,4,5-trihydroxy-3-[3-(phenylsulfanyl)phenyl]cyclohex-2-ene-1-carboxylic acid ChemAxon Molecular Weight 358.408 ChemAxon Monoisotopic Weight 358.087494376 ChemAxon SMILES [H][C@@]1(O)C[C@@](O)(C=C(C2=CC=CC(SC3=CC=CC=C3)=C2)[C@@]1([H])O)C(O)=O ChemAxon Molecular Formula C19H18O5S ChemAxon InChI InChI=1S/C19H18O5S/c20-16-11-19(24,18(22)23)10-15(17(16)21)12-5-4-8-14(9-12)25-13-6-2-1-3-7-13/h1-10,16-17,20-21,24H,11H2,(H,22,23)/t16-,17-,19+/m1/s1 ChemAxon InChIKey InChIKey=QMNMNSINKIFYBV-LMMKCTJWSA-N ChemAxon Polar Surface Area (PSA) 97.99 ChemAxon Refractivity 96.26 ChemAxon Polarizability 36.7 ChemAxon Rotatable Bond Count 4 ChemAxon H Bond Acceptor Count 5 ChemAxon H Bond Donor Count 4 ChemAxon pKa (strongest acidic) 3.29 ChemAxon pKa (strongest basic) -3.2 ChemAxon Physiological Charge -1 ChemAxon Number of Rings 3 ChemAxon Bioavailability 1 ChemAxon Rule of Five true ChemAxon Ghose Filter true ChemAxon PubChem Compound 16058682 PubChem Substance 99444956 ChemSpider 17218400 PDB RP4 BE0001769 3-dehydroquinate dehydratase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) # Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE: The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. "Pubmed":http://www.ncbi.nlm.nih.gov/pubmed/10592235 unknown 3-dehydroquinate dehydratase Amino acid transport and metabolism Catalyzes a trans-dehydration via an enolate intermediate aroQ None 6.41 16682.0 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GenBank Gene Database AJ001493 GenBank Protein Database 2558614 UniProtKB P15474 UniProt Accession AROQ_STRCO 3-dehydroquinase EC 4.2.1.10 Type II DHQase >3-dehydroquinate dehydratase MPRSLANAPIMILNGPNLNLLGQRQPEIYGSDTLADVEALCVKAAAAHGGTVDFRQSNHE GELVDWIHEARLNHCGIVINPAAYSHTSVAILDALNTCDGLPVVEVHISNIHQREPFRHH SYVSQRADGVVAGCGVQGYVFGVERIAALAGAGSARA >474 bp GTGCCCCGCAGCCTGGCCAACGCCCCGATCATGATCCTCAACGGCCCCAACCTGAACCTG CTCGGCCAGCGCCAGCCGGAGATCTACGGCTCCGACACCCTCGCCGACGTCGAGGCGCTG TGCGTGAAGGCGGCGGCCGCGCACGGCGGCACGGTGGACTTCCGGCAGTCCAACCACGAG GGCGAACTGGTCGACTGGATCCACGAGGCCCGGCTGAACCACTGCGGGATCGTGATCAAC CCCGCCGCCTACTCGCACACGTCCGTCGCCATCCTGGATGCGCTCAACACCTGCGACGGG CTGCCGGTGGTGGAGGTCCACATCTCCAACATCCACCAGCGTGAGCCGTTCCGGCACCAC TCCTACGTCTCGCAGCGCGCCGACGGCGTCGTCGCGGGGTGCGGTGTGCAGGGGTACGTC TTCGGTGTGGAGCGGATCGCCGCCCTGGCCGGGGCGGGCTCGGCCAGGGCCTGA PF01220 DHquinase_II function carbon-oxygen lyase activity function hydro-lyase activity function 3-dehydroquinate dehydratase activity function catalytic activity function lyase activity process amino acid and derivative metabolism process amino acid biosynthesis process aromatic amino acid family biosynthesis process physiological process process metabolism process cellular metabolism process amino acid metabolism "
rdfs:label
"(1S,4S,5S)-1,4,5-TRIHYDROXY-3-[3-(PHENYLTHIO)PHENYL]CYCLOHEX-2-ENE-1-CARBOXYLIC ACID"
rdf:type

All properties reside in the graph file:///home/swish/src/ClioPatria/guidelines/drugbank_small.nt

The resource does not appear as an object

Context graph